Recombinant Human Retinoblastoma binding protein 6 (ab159317)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SSGNKLLYILNPPETQVEKEQITGQIDKSTVKPKPQLSHSSRLSSDLTRE TDEAAFEPDYNESDSESNVSVKEEESSGNISKDLKDKIVEKAKESLDTAA VVQVGISRNQ
    • Amino acids
      1582 to 1691
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686P0638
    • DKFZp761B2423
    • E3 ubiquitin-protein ligase RBBP6
    • MY038
    • P2P R
    • P2PR
    • p53 associated cellular protein of testis
    • p53-associated cellular protein of testis
    • p53-associated cellular protein, testis-derived
    • PACT
    • Proliferation potential related protein
    • Proliferation potential-related protein
    • Protein P2P R
    • Protein P2P-R
    • Protein P2PR
    • Protein RBQ 1
    • Protein RBQ1
    • RB binding protein 6, ubiquitin ligase
    • RB binding Q protein 1
    • RBBP 6
    • Rbbp6
    • RBBP6_HUMAN
    • RBQ 1
    • RBQ-1
    • RBQ1
    • Retinoblastoma binding protein 6 isoform 3
    • Retinoblastoma binding Q protein 1
    • Retinoblastoma-binding protein 6
    • Retinoblastoma-binding Q protein 1
    • SNAMA
    • SNAMA, Drosophila, homolog of
    see all
  • Function
    E3 ubiquitin-protein ligase which promotes ubiquitination of YBX1, leading to its degradation by the proteasome. May play a role as a scaffold protein to promote the assembly of the p53/TP53-MDM2 complex, resulting in increase of MDM2-mediated ubiquitination and degradation of p53/TP53; may function as negative regulator of p53/TP53, leading to both apoptosis and cell growth.
  • Tissue specificity
    Highly expressed in the placenta and testis. Expressed at lower levels in the brain, heart, kidney, liver and lung. Overexpressed in esophageal cancer.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 CCHC-type zinc finger.
    Contains 1 DWNN domain.
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR. Phosphorylated by NEK6.
  • Cellular localization
    Nucleus > nucleolus. Chromosome. Cytoplasm > cytoskeleton > centrosome. Colocalizes with mitotic chromosomes. Co-localizes with NEK6 in the centrosome.
  • Information by UniProt

Images

  • ab159317 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159317 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159317.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up