Recombinant Human Retinoid X Receptor gamma protein (ab114438)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP48443
    • SpeciesHuman
    • SequenceMYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPV SAPRTLSAVGTPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQL NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH YGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLIDKRQRNRCQYCRYQKCL VMGMKREAVQEERQRSRERAESEAECATSGHEDMPVERILEAELAVEPKT ESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRV LTELVSKMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYAT LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT FLMEMLETPLQIT
    • Molecular weight77 kDa including tags
    • Amino acids1 to 463

Specifications

Our Abpromise guarantee covers the use of ab114438 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC109416
    • NR2B3
    • Nuclear receptor subfamily 2 group B member 3
    • OTTHUMP00000060418
    • Retanoic X receptor gamma
    • Retinoic acid receptor RXR gamma
    • Retinoic acid receptor RXR-gamma
    • Retinoid X receptor gamma
    • RXR G
    • RXR gamma
    • RXRC
    • Rxrg
    • RXRG_HUMAN
    • RXRgamma
    see all
  • FunctionReceptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. The high affinity ligand for RXRs is 9-cis retinoic acid.
  • Sequence similaritiesBelongs to the nuclear hormone receptor family. NR2 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • DomainComposed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Retinoid X Receptor gamma protein images

  • ab114438 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Retinoid X Receptor gamma protein (ab114438)

ab114438 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114438.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"