Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SPAKTLPGACGSPQKLIDGFLKHEGPPAEKPLEELSASTSGVPGLSSLQS DPAGCVRPPAPNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYC
    • Amino acids
      1097 to 1194
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162562 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AIBP 80
    • AIBP80
    • Alpha integrin binding protein 80
    • Alpha integrin-binding protein 80
    • DNA repair protein REV 1
    • DNA repair protein REV1
    • FLJ21523
    • MGC163283
    • MGC26225
    • REV 1
    • REV 1 (yeast homolog) like
    • REV 1 homolog
    • REV 1 like
    • REV 1 protein
    • REV 1L
    • REV1
    • REV1 (yeast homolog) like
    • REV1 homolog
    • REV1 homolog (S. cerevisiae)
    • REV1 like
    • REV1 like (yeast)
    • Rev1 like terminal deoxycytidyl transferase
    • REV1 protein
    • Rev1-like terminal deoxycytidyl transferase
    • REV1_HUMAN
    • REV1L
    see all
  • Function
    Deoxycytidyl transferase involved in DNA repair. Transfers a dCMP residue from dCTP to the 3'-end of a DNA primer in a template-dependent reaction. May assist in the first step in the bypass of abasic lesions by the insertion of a nucleotide opposite the lesion. Required for normal induction of mutations by physical and chemical agents.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the DNA polymerase type-Y family.
    Contains 1 BRCT domain.
    Contains 1 umuC domain.
  • Domain
    The C-terminal domain is necessary for protein interactions.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162562 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162562 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162562.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up