Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSVREGGAAMAAGESMAQRMVWVDLEMTG LDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHG KSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLD KYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISE SIKELQFYRNNIFKKKIDEKKRKIIENGENEKTVS
    • Molecular weight
      27 kDa including tags
    • Amino acids
      26 to 237
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156973 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab156973 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • 1810038D15Rik
    • AW107347
    • CGI 114
    • DKFZP566E144
    • MGC105914
    • MGC111570
    • mitochondrial
    • Oligoribonuclease
    • Oligoribonuclease, mitochondrial [Precursor]
    • ORN_HUMAN
    • REX2, RNA exonuclease 2 homolog (S. cerevisiae)
    • REXO2
    • RFN
    • RNA exonuclease 2
    • RNA exonuclease 2 homolog
    • SFN
    • Small fragment nuclease
    • Smfn
    see all
  • Function
    3'-to-5' exoribonuclease specific for small oligoribonucleotides. Active on small (primarily
  • Sequence similarities
    Belongs to the oligoribonuclease family.
    Contains 1 exonuclease domain.
  • Cellular localization
    Mitochondrion and Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156973 (3µg).

References

ab156973 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156973.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up