Overview

  • Product name
    Recombinant Human RFX1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SKYHYYGLRIKASSPLLRLMEDQQHMAMRGQPFSQKQRLKPIQKMEGMTN GVAVGQQPSTGLSDISAQVQQYQQFLDASRSLPDFTELDLQGKVLPEGV
    • Amino acids
      502 to 600
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159333 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI047719
    • AI385641
    • EF-C
    • EFC
    • Enhancer factor C
    • MHC class II regulatory factor RFX
    • MHC class II regulatory factor RFX1
    • Regulatory factor X 1
    • Regulatory factor X, 1 (influences HLA class II expression)
    • Regulatory factor X1
    • RFX
    • RFX-1
    • Rfx1
    • RFX1_HUMAN
    • Trans-acting regulatory factor 1
    • Transcription factor RFX1
    see all
  • Function
    Regulatory factor essential for MHC class II genes expression. Binds to the X boxes of MHC class II genes. Also binds to an inverted repeat (ENH1) required for hepatitis B virus genes expression and to the most upstream element (alpha) of the RPL30 promoter.
  • Sequence similarities
    Belongs to the RFX family.
    Contains 1 RFX-type winged-helix DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159333 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159333 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159333.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up