Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNWAAFGGSEFFIPEGIQIDSRCPLSRNITEWYHYYGIAVKESSQYYDVM YSKKGAAWVSETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLPASLP EEKVSTFIMMYRTHCQRILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLG SSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLTQVIRKFAKQLDEWL KVALHDLPENLRNIKFELSRRFSQILRRQTSLNHLCQASRTVIHSADITF QMLEDWRNVDLNSITKQTLYTMEDSRDEHRKLITQLYQEFDHLLEEQSPI ESYIEWLDTMVDRCVVKVAAKRQGSLKKVAQQFLLMWSCFGTRVIRDMTL HSAPSFGSFHLIHLMFDDYVLYLLESLHCQERANELMRAMKGEGSTAEVR EEIILTEAAAPTPSPVPSFSPAKSATSVEVPPPSSPVSNPSPEYTGLSTT GAMQSYTWSLTYTVTTAAGSPAENSQQLPCMRNTHVPSSSVTHRIPVYPH REEHGYTGSYNYGSYGNQHPHPMQSQYPALPHDTAISGPLHYAPYHRSSA QYPFNSPTSRMEPCLMSSTPRLHPTPVTPRWPEVPSANTCYTSPSVHSAR YGNSSDMYTPLTTRRNSEYEHMQHFPGFAYINGEASTGWAK
    • Amino acids
      1 to 641
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159337 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • NYD SP10
    • Regulatory factor X 4
    • Regulatory factor X, 4 (influences HLA class II expression)
    • Regulatory factor X4 isoform E
    • Regulatory factor X4 isoform F
    • Regulatory factor X4, isoform c
    • Regulatory factor X4, isoform d
    • rfx4
    • RFX4_HUMAN
    • Testis development protein NYD SP10
    • Testis development protein NYD-SP10
    • Transcription factor RFX4
    • Winged helix transcription factor RFX4
    • Winged helix transcription factor RFX4 variant 3
    see all
  • Function
    May activate transcription by interacting directly with the X-box.
  • Tissue specificity
    Isoform 4 is testis-specific. Isoform 1 is expressed in brain and gliomas. Isoform 2 and isoform 3 are testis-specific (at protein level). Isoform 1 is expressed in brain (at protein level). Isoform 3 is expressed at a higher level in adult testes and ejaculated spematozoa than in fetal testes.
  • Sequence similarities
    Belongs to the RFX family.
    Contains 1 RFX-type winged-helix DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159337 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159337 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159337.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up