Overview

  • Product name
    Recombinant Human RGL2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PGASDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAV ASEYELVQLLPGERELTIPASANVFYAMDGASHDFLLRQRRRSSTATPGV
    • Molecular weight
      37 kDa including tags
    • Amino acids
      644 to 743

Specifications

Our Abpromise guarantee covers the use of ab116919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GDS related protein
    • HKE1.5
    • KE1.5
    • RAB2L
    • Ral guanine nucleotide dissociation stimulator-like 2
    • RalGDS-like 2
    • RalGDS-like factor
    • Ras-associated protein RAB2L
    • RGL2
    • RGL2_HUMAN
    see all
  • Function
    Probable guanine nucleotide exchange factor. Putative effector of Ras and/or Rap. Associates with the GTP-bound form of Rap 1A and H-Ras in vitro.
  • Sequence similarities
    Contains 1 N-terminal Ras-GEF domain.
    Contains 1 Ras-associating domain.
    Contains 1 Ras-GEF domain.
  • Information by UniProt

Recombinant Human RGL2 protein images

  • 12.5% SDS-PAGE showing ab116919 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human RGL2 protein (ab116919)

ab116919 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up