Overview

  • Product name
    Recombinant Human RGS10 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHH SSGLVPRGSH MGSH MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPE GVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSS KASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSD LFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 181
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab109947 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Regulator of G protein signaling 10
    • Regulator of G-protein signaling 10
    • RGS10
    • RGS10_HUMAN
  • Function
    Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Associates specifically with the activated forms of the G protein subunits G(i)-alpha and G(z)-alpha but fails to interact with the structurally and functionally distinct G(s)-alpha subunit. Activity on G(z)-alpha is inhibited by palmitoylation of the G-protein.
  • Sequence similarities
    Contains 1 RGS domain.
  • Post-translational
    modifications
    Isoform 3 is phosphorylated on Ser-16.
  • Information by UniProt

Recombinant Human RGS10 protein images

  • ab109947 at 3 ug on an SDS-PAGE gel (15%)

References for Recombinant Human RGS10 protein (ab109947)

ab109947 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up