Overview

  • Product name
    Recombinant Human RGS19 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPTPHEAEKQITGPEEADRPPSMSSHDTAS PAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPS PEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEA NQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDA QLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA
    • Molecular weight
      27 kDa including tags
    • Amino acids
      1 to 217
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101949 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101949 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, PBS, pH 7.4

General Info

  • Alternative names
    • G alpha interacting protein
    • G protein signalling regulator 19
    • G protein, alpha-interacting protein
    • G-alpha-interacting protein
    • GAIP
    • GNAI3IP
    • Guanine nucleotide binding protein alpha inhibiting activity polypeptide 3 interacting protein
    • Regulator of G protein signalling 19
    • Regulator of G-protein signaling 19
    • RGS19
    • RGS19_HUMAN
    • RGSGAIP
    see all
  • Function
    Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G-alpha subfamily 1 members, with the order G(i)a3 > G(i)a1 > G(o)a >> G(z)a/G(i)a2. Activity on G(z)-alpha is inhibited by phosphorylation and palmitoylation of the G-protein.
  • Tissue specificity
    Highest expression in lung. Placenta, liver and heart also express high levels of GAIP.
  • Sequence similarities
    Contains 1 RGS domain.
  • Post-translational
    modifications
    Fatty acylated. Heavily palmitoylated in the cysteine string motif.
    Phosphorylated, mainly on serine residues.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab101949.

References

ab101949 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101949.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up