Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMQSAMFLAVQHDCRPMDKSAGSGHKSEEKR EKMKRTLLKDWKTRLSYFLQNSSTPGKPKTGKKSKQQAFIKPSPEEAQLW SEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSS KARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL MENNSYPRFLESEFYQDLCKKPQITTEPHAT
    • Molecular weight
      27 kDa including tags
    • Amino acids
      1 to 211
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104636 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab104636 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • Basic helix-loop-helix phosphoprotein G0S8
    • Cell growth inhibiting protein 31
    • Cell growth-inhibiting gene 31 protein
    • G0 to G1 switch regulatory 8 24kD
    • G0/G1 switch regulatory protein 8
    • G0S8
    • GOS8
    • OTTHUMP00000060765
    • Regulator of G protein signaling 2
    • Regulator of G protein signalling 2 24kD
    • Regulator of G-protein signaling 2
    • Regulators of G protein signaling XRGSVI
    • RGS 2
    • RGS2
    • RGS2_HUMAN
    see all
  • Function
    Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form (PubMed:11063746, PubMed:19478087). Plays a role in the regulation of blood pressure in response to signaling via G protein-coupled receptors and GNAQ. Plays a role in regulating the constriction and relaxation of vascular smooth muscle (By similarity). Binds EIF2B5 and blocks its activity, thereby inhibiting the translation of mRNA into protein (PubMed:19736320).
  • Tissue specificity
    Expressed in acute myelogenous leukemia (AML) and in acute lymphoblastic leukemia (ALL).
  • Sequence similarities
    Contains 1 RGS domain.
  • Post-translational
    modifications
    Phosphorylated by protein kinase C. Phosphorylation by PRKG1 leads to activation of RGS2 activity.
  • Cellular localization
    Cell membrane. Mitochondrion and Cell membrane. Cytoplasm. Nucleus, nucleolus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab104636.

References

ab104636 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104636.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up