Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP41220
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMQSAMFLAVQHDCRPMDKSAGSGHKSEEKR EKMKRTLLKDWKTRLSYFLQNSSTPGKPKTGKKSKQQAFIKPSPEEAQLW SEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSS KARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL MENNSYPRFLESEFYQDLCKKPQITTEPHAT
    • Molecular weight27 kDa including tags
    • Amino acids1 to 211
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104636 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab104636 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • Basic helix-loop-helix phosphoprotein G0S8
    • Cell growth inhibiting protein 31
    • Cell growth-inhibiting gene 31 protein
    • G0 to G1 switch regulatory 8 24kD
    • G0/G1 switch regulatory protein 8
    • G0S8
    • GOS8
    • OTTHUMP00000060765
    • Regulator of G protein signaling 2
    • Regulator of G protein signalling 2 24kD
    • Regulator of G-protein signaling 2
    • Regulators of G protein signaling XRGSVI
    • RGS 2
    • RGS2
    • RGS2_HUMAN
    see all
  • FunctionRegulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form (PubMed:11063746, PubMed:19478087). Plays a role in the regulation of blood pressure in response to signaling via G protein-coupled receptors and GNAQ. Plays a role in regulating the constriction and relaxation of vascular smooth muscle (By similarity). Binds EIF2B5 and blocks its activity, thereby inhibiting the translation of mRNA into protein (PubMed:19736320).
  • Tissue specificityExpressed in acute myelogenous leukemia (AML) and in acute lymphoblastic leukemia (ALL).
  • Sequence similaritiesContains 1 RGS domain.
  • Post-translational
    modifications
    Phosphorylated by protein kinase C. Phosphorylation by PRKG1 leads to activation of RGS2 activity.
  • Cellular localizationCell membrane. Mitochondrion and Cell membrane. Cytoplasm. Nucleus, nucleolus.
  • Information by UniProt

Recombinant Human RGS2 protein images

  • 15% SDS-PAGE analysis of 3µg ab104636.

References for Recombinant Human RGS2 protein (ab104636)

ab104636 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104636.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"