Overview

  • Product nameRecombinant Human RGS3 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP49796
    • SpeciesHuman
    • SequenceMLRGMYLTRNGNLQRRHTMKEAKDMKNKLGIFRRRSESPGAPPAGKADKM MKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLAC EDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVT RGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
    • Molecular weight47 kDa including tags
    • Amino acids1 to 193

Specifications

Our Abpromise guarantee covers the use of ab116894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C2PA
    • FLJ20370
    • FLJ31516
    • FLJ90496
    • PDZ RGS 3
    • PDZ RGS3
    • Regulator of G protein signaling 3
    • Regulator of G protein signalling 3
    • Regulator of G-protein signaling 3
    • RGP 3
    • RGP3
    • RGS 3
    • RGS3
    • RGS3_HUMAN
    see all
  • FunctionDown-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activation of MAP kinases.
  • Sequence similaritiesContains 1 C2 domain.
    Contains 1 PDZ (DHR) domain.
    Contains 1 RGS domain.
  • Post-translational
    modifications
    Phosphorylated by cyclic GMP-dependent protein kinase.
    ISGylated.
  • Cellular localizationCytoplasm. Nucleus. Cell membrane. Long isoforms are cytoplasmic and associated with the plasma membrane. Short isoforms are nuclear.
  • Information by UniProt

Recombinant Human RGS3 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116894.

References for Recombinant Human RGS3 protein (ab116894)

ab116894 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"