Overview

  • Product name
    Recombinant Human RGS3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLRGMYLTRNGNLQRRHTMKEAKDMKNKLGIFRRRSESPGAPPAGKADKM MKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLAC EDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVT RGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
    • Molecular weight
      47 kDa including tags
    • Amino acids
      1 to 193

Specifications

Our Abpromise guarantee covers the use of ab116894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C2PA
    • FLJ20370
    • FLJ31516
    • FLJ90496
    • PDZ RGS 3
    • PDZ RGS3
    • Regulator of G protein signaling 3
    • Regulator of G protein signalling 3
    • Regulator of G-protein signaling 3
    • RGP 3
    • RGP3
    • RGS 3
    • RGS3
    • RGS3_HUMAN
    see all
  • Function
    Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activation of MAP kinases.
  • Sequence similarities
    Contains 1 C2 domain.
    Contains 1 PDZ (DHR) domain.
    Contains 1 RGS domain.
  • Post-translational
    modifications
    Phosphorylated by cyclic GMP-dependent protein kinase.
    ISGylated.
  • Cellular localization
    Cytoplasm. Nucleus. Cell membrane. Long isoforms are cytoplasmic and associated with the plasma membrane. Short isoforms are nuclear.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116894.

References

ab116894 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up