Overview

  • Product name
    Recombinant Human RGS4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMCKGLAGLPASCLRSAKDMKHRLGFLLQKS DSCEHNSSHNKKDKVVIC QRVSQEEVKKWAESLENLISHECGLAAFKA FLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQA TKE VNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLD LVNPSSCGAEKQKGAKSSADCA SLVPQCA
    • Molecular weight
      25 kDa including tags
    • Amino acids
      1 to 205
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113136 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113136 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.08% DTT, 10% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • MGC2124
    • MGC60244
    • Regulator of G protein signalling 4
    • Regulator of G-protein signaling 4
    • RGP 4
    • RGP4
    • RGS 4
    • RGS4
    • RGS4_HUMAN
    • Schizophrenia disorder 9
    • SCZD 9
    • SCZD9
    see all
  • Function
    Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(z)-alpha is inhibited by phosphorylation of the G-protein. Activity on G(z)-alpha and G(i)-alpha-1 is inhibited by palmitoylation of the G-protein.
  • Involvement in disease
    Genetic variation in RGS4 is associated with susceptibility to schizophrenia type 9 (SCZD9) [MIM:604906]. A complex, multifactorial psychotic disorder or group of disorders characterized by disturbances in the form and content of thought (e.g. delusions, hallucinations), in mood (e.g. inappropriate affect), in sense of self and relationship to the external world (e.g. loss of ego boundaries, withdrawal), and in behavior (e.g bizarre or apparently purposeless behavior). Although it affects emotions, it is distinguished from mood disorders in which such disturbances are primary. Similarly, there may be mild impairment of cognitive function, and it is distinguished from the dementias in which disturbed cognitive function is considered primary. Some patients manifest schizophrenic as well as bipolar disorder symptoms and are often given the diagnosis of schizoaffective disorder.
  • Sequence similarities
    Contains 1 RGS domain.
  • Post-translational
    modifications
    Palmitoylated on Cys-2 and/or Cys-12.
    Phosphorylated by cyclic GMP-dependent protein kinase.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab113136.

References

ab113136 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113136.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up