Overview

  • Product name
    Recombinant Human RGS5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMCKGLAALPHSCLERAKEIKIKLGIL LQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLA SFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAP KEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFY QELIK
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 181
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113146 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113146 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • MST092
    • MST106
    • MST129
    • MSTP032
    • MSTP092
    • MSTP106
    • MSTP129
    • Regulator of G Protein Signalling 5
    • Regulator of G-protein signaling 5
    • RGS 5
    • RGS5
    • RGS5_HUMAN
    see all
  • Function
    Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha.
  • Sequence similarities
    Contains 1 RGS domain.
  • Information by UniProt

Recombinant Human RGS5 protein images

  • 15% SDS-PAGE analysis of ab113146 (3 µg)

References for Recombinant Human RGS5 protein (ab113146)

ab113146 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113146.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up