Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTEESQAQSPVHVLSQPIRKT TKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYDPLITPAEPS
    • Amino acids
      207 to 306
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160585 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ43552
    • G protein signaling 6 regulator
    • GAP
    • GTPase activating protein
    • MGC142132
    • Regulator of G protein signaling 6
    • Regulator of G protein signalling 6
    • Regulator of G-protein signaling 6
    • RGS 6
    • RGS6
    • RGS6_HUMAN
    • S914
    see all
  • Function
    Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(o)-alpha is specifically enhanced by the RGS6/Gbeta5 dimer.
  • Sequence similarities
    Contains 1 DEP domain.
    Contains 1 G protein gamma domain.
    Contains 1 RGS domain.
  • Cellular localization
    Cytoplasm. Membrane.
  • Information by UniProt

Images

  • ab160585 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160585 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160585.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up