Recombinant Human RHBDD2 protein (ab163548)

Overview

  • Product name
    Recombinant Human RHBDD2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLGVTTVRSRMRRALVFGMVVPSVLVPWLLLGASWLIPQTSFLSNVCGLS IGLAYGLTYCYSIDLSERVALKLDQTFPFSLMRRISVFKYVSGSSAERRA AQSRKLNPVPGSYPTQSCHPHLSPSHPVSQTQHASGQKLASWPSCTPGHM PTLPPYQPASGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGT VYSGALGTPGAAGSKESSRVPMP
    • Amino acids
      1 to 223
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163548 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • H_RG122E10.2a
    • H_RG122E10.2b
    • NPD007
    • RHBD2_HUMAN
    • RHBDD2
    • RHBDL7
    • Rhomboid domain containing 2
    • rhomboid domain containing protein 2
    • Rhomboid domain-containing protein 2
    • Rhomboid veinlet like 7
    • WUGSC:H_RG122E10.2a
    • WUGSC:H_RG122E10.2b
    see all
  • Sequence similarities
    Belongs to the peptidase S54 family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163548 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163548 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163548.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up