Recombinant Human RhD protein (ab80087)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEVTALGNLRMVI SNIFNTDY
    • Amino acids
      108 to 165

Specifications

Our Abpromise guarantee covers the use of ab80087 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: PBS

  • Reconstitution
    Redissolve the powder with 1ml sterile water.

General Info

  • Alternative names
    • Blood group Rh(D) polypeptide
    • Blood group--Rhesus system D polypeptide
    • CD240D
    • D antigen (DCS)
    • DIIIc
    • MGC165007
    • RH
    • Rh blood group antigen Evans
    • Rh blood group D antigen
    • Rh polypeptide 2
    • RH30
    • Rh4
    • RHCED
    • Rhd
    • RHD_HUMAN
    • RhDCw
    • RHDel
    • RHDVA(TT)
    • Rhesus blood group D antigen allele DIII type 7
    • Rhesus D antigen
    • Rhesus system D polypeptide
    • RhII
    • RhK562-II
    • RhPI
    • RHPII
    • RHXIII
    see all
  • Function
    May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
  • Tissue specificity
    Restricted to tissues or cell lines expressing erythroid characters.
  • Sequence similarities
    Belongs to the ammonium transporter (TC 2.A.49) family. Rh subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 20% SDS PAGE showing ab80087 at approximately 13kDa.

References

ab80087 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting us and your interest in our products.

The RhD protein (His tag) (ab80087) is not the full length RhD protein but a truncation of the residues 108-165 of the human protein(SwissProt reference Q02161) with an N-terminal...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up