Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAAIRKKLVVVGDGACGKTCLLIVFSKDEF PEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVI LMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTE LARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQ KRYGSQNGCINCC
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 193
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107139 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab107139 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • Aplysia RAS-related homolog 6
    • ARH6
    • ARHB
    • H6
    • MST081
    • MSTP081
    • oncogene RHO H6
    • ras homolog family member B
    • ras homolog gene family, member B
    • Rho cDNA clone 6
    • Rho related GTP binding protein RhoB Precursor
    • Rho-related GTP-binding protein RhoB
    • Rhob
    • RHOB_HUMAN
    • RHOH6
    see all
  • Function
    Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rho family.
  • Post-translational
    modifications
    Prenylation specifies the subcellular location of RHOB. The farnesylated form is localized to the plasma membrane while the geranylgeranylated form is localized to the endosome.
  • Cellular localization
    Late endosome membrane. Cell membrane. Nucleus. Late endosomal membrane (geranylgeranylated form). Plasma membrane (farnesylated form). Also detected at the nuclear margin and in the nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab107139 (3µg).
    Note: Molecular weight on SDS-PAGE will appear higher than predicted.

References

This product has been referenced in:
  • Reichman M  et al. A High-Throughput Assay for Rho Guanine Nucleotide Exchange Factors Based on the Transcreener GDP Assay. J Biomol Screen 20:1294-9 (2015). Read more (PubMed: 26195453) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107139.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up