Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP08134
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAAIRKKLVIVGDGACGKTCLLIVFSKDQF PEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVI LMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRE LAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQ VRKNKRRRGC
    • Molecular weight24 kDa including tags
    • Amino acids1 to 190
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab98085 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 0.1mM DTT, pH 8.0

General Info

  • Alternative names
    • Aplysia RAS-related homolog 9
    • ARH 9
    • ARH9
    • ARHC
    • H9
    • MGC1448
    • MGC61427
    • Oncogene RHO H9
    • Ras homolog gene family member C
    • RAS related homolog 9
    • RHO C
    • Rho cDNA clone 9
    • Rho related GTP binding protein RhoC
    • Rho-related GTP-binding protein RhoC
    • rhoC
    • RhoC GTPase
    • RHOC_HUMAN
    • RHOH 9
    • RHOH9
    • Small GTP binding protein RhoC
    see all
  • FunctionRegulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rho family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human RHOC protein images

  • 15% SDS-PAGE analysis of 3µg ab98085

References for Recombinant Human RHOC protein (ab98085)

ab98085 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"