Recombinant Human Rhodamine protein (Rhodamine) (ab189699)

Overview

  • Product name
    Recombinant Human Rhodamine protein (Rhodamine)
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYL VPSDITVAQF MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKE KDEDGFLYVAYSGENTFGF
    • Molecular weight
      16 kDa including tags
    • Amino acids
      1 to 117
    • Tags
      His tag N-Terminus
  • Conjugation
    Rhodamine. Ex: 550nm, Em: 570nm

Specifications

Our Abpromise guarantee covers the use of ab189699 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Additional notes

    ab189699 gives a strong signal in the range of 0.1-1 μM, depending on exact experimental conditions.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Do Not Freeze. Store In the Dark.

    pH: 7.5
    Constituents: 1.19% HEPES, 0.58% Sodium chloride

References

ab189699 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189699.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up