Overview

  • Product name
    Recombinant Human RhoF protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDAPGALAQTAAPGPGRKELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAP SVFEKYTASVTVGSKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDV MNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQL EPITYMQVGRGQDPGAQPWL
    • Amino acids
      1 to 170
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162763 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARHF
    • FLJ20247
    • Ras homolog gene family member F
    • Ras homolog gene family member F (in filopodia)
    • Rho F
    • Rho family GTPase Rif
    • Rho in filopodia
    • Rho related GTP binding protein RhoF
    • Rho-related GTP-binding protein RhoF
    • Rhof
    • RHOF_HUMAN
    • RIF
    see all
  • Function
    Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. Causes the formation of thin, actin-rich surface projections called filopodia. Functions cooperatively with CDC42 and Rac to generate additional structures, increasing the diversity of actin-based morphology.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rho family.
  • Cellular localization
    Cell membrane. Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab162763 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162763 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162763.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up