Overview

  • Product name
    Recombinant Human RHOJ protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEY VPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICF SVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYM KEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKK KKRCSEGHSCCSII
    • Amino acids
      1 to 214
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153447 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARHJ
    • Ras homolog family member J
    • Ras homolog gene family member J
    • RAS like family 7 member B
    • Ras like protein family member 7B
    • Ras-like protein family member 7B
    • RASL 7B
    • RASL7B
    • Rho related GTP binding protein RhoJ
    • Rho-related GTP-binding protein RhoJ
    • RHOI
    • Rhoj
    • RHOJ_HUMAN
    • Tc10 like GTP binding protein TCL
    • TC10 like Rho GTPase
    • Tc10-like GTP-binding protein
    • TC10B
    • TCL
    see all
  • Function
    GTP-binding protein with GTPase activity. Elicits the formation of F-actin-rich structures in fibroblasts and is involved in the regulation of cell morphology.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rho family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab153447 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153447 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153447.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up