Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFK DLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQ ASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPPPPEPLS QVSMWDQRWQDHQPLLPITDVP
    • Amino acids
      1 to 172
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162767 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AB1IP
    • Amyloid beta A4 precursor protein binding family B member 1 interacting protein
    • Amyloid beta precursor protein binding family B member 1
    • APBB1 interacting protein 1
    • INAG1
    • OTTHUMP00000019344
    • PREL 1
    • PREL1
    • Proline rich EVH1 ligand 1
    • Proline rich protein 73
    • Rap1 GTP interacting adapter molecule
    • RAP1 interacting adaptor molecule
    • RARP 1
    • RARP1
    • Retinoic acid responsive proline rich protein 1
    see all
  • Relevance
    RIAM (Rap1-GTP interacting adapter molecule) appears to function in the signal transduction from Ras activation to actin cytoskeletal remodeling via interaction with profilin and VASP. It suppresses insulin-induced promoter activities through AP1 and SRE and also mediates Rap1-induced adhesion.
  • Cellular localization
    Cell Membrane, Cytoplasm and cytoskeleton

Images

  • ab162767 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162767 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162767.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up