Recombinant Human Ribophorin II protein (ab114914)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP04844
    • SpeciesHuman
    • SequenceMAPPGSSTVFLLALTIIASTWALTPTHYLTKHDVERLKASLDRPFTNLES AFYSIVGLSS LGAQVPDAKKACTYIRSNLDPSNVDSLFYAAQASQALS GCEISISNETKDLLLAAVSEDS SVTQIYHAVAALSGFGLPLASQEALS ALTARLSKEETVLATVQALQTASHLSQQADLRSI VEEIEDLVARLDEL GGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAI FS KKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQV TNVLSQPL TQATVKLEHAKSVASRATVLQKTSFTPVGDVFELNFMNVK FSSGYYDFLVEVEGDNRYIA NTVELRVKISTEVGITNVDLSTVDKDQS IAPKTTRVTYPAKAKGTFIADSHQNFALFFQL VDVNTGAELTPHQTFV RLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYT LYLI IGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPE KRPPTV VSNTFTALILSPLLLLFALWIRIGANVSNFTFAPSTIIFHLG HAAMLGLMYVYWTQLNMF QTLKYLAILGSVTFLAGNRMLAQQAVKRTA H
    • Molecular weight95 kDa including tags
    • Amino acids1 to 631

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114914 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dolichyl diphosphooligosaccharide protein glycosyltransferase 63 kDa subunit precursor
    • Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit
    • Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2
    • EC 2.4.1.119
    • RIBIIR
    • Ribophorin II
    • Ribophorin-2
    • RPN 2
    • RPN II
    • RPN-II
    • rpn2
    • RPN2_HUMAN
    • RPNII
    • SWP1
    see all
  • FunctionEssential subunit of N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains.
  • Tissue specificityExpressed in all tissues tested.
  • Sequence similaritiesBelongs to the SWP1 family.
  • Cellular localizationEndoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human Ribophorin II protein images

  • 12.5% SDS-PAGE showing ab114914 at approximately 95.48kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Ribophorin II protein (ab114914)

ab114914 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114914.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"