Recombinant Human Ribosomal protein S10 (ab116863)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP46783
    • SpeciesHuman
    • SequenceMLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQ SLKSRGYVKEQFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRSRPE TGKPRPKGLEGERPARLTRGEADRDTYRRSAVPPGADKKAEAGAGSATEF QFRGGFGRGRGQPPQ
    • Molecular weight44 kDa including tags
    • Amino acids1 to 165

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116863 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 40S ribosomal protein S10
    • DBA9
    • MGC88819
    • OTTHUMP00000016229
    • OTTHUMP00000016230
    • RPS10
    • RS10_HUMAN
    • S10
    see all
  • FunctionComponent of the 40S ribosomal subunit.
  • Involvement in diseaseDefects in RPS10 are the cause of Diamond-Blackfan anemia type 9 (DBA9) [MIM:613308]. It is a form of Diamond-Blackfan anemia, a congenital non-regenerative hypoplastic anemia that usually presents early in infancy. Diamond-Blackfan anemia is characterized by a moderate to severe macrocytic anemia, erythroblastopenia, and an increased risk of malignancy. 30 to 40% of Diamond-Blackfan anemia patients present with short stature and congenital anomalies, the most frequent being craniofacial (Pierre- Robin syndrome and cleft palate), thumb and urogenital anomalies.
  • Sequence similaritiesBelongs to the ribosomal protein S10e family.
  • Post-translational
    modifications
    Methylated by PRMT5. Methylation is necessary for its interaction with NPS1, its localization in the granular component (GC) region of the nucleolus, for the proper assembly of ribosomes, protein synthesis and optimal cell proliferation.
  • Cellular localizationCytoplasm. Nucleus > nucleolus. Localized in the granular component (GC) region of the nucleolus. Methylation is required for its localization in the GC region. Co-localizes with NPS1 in the GC region of the nucleolus.
  • Information by UniProt

Recombinant Human Ribosomal protein S10 images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116863 at approximately 43.89 kDa.

References for Recombinant Human Ribosomal protein S10 (ab116863)

ab116863 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116863.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"