Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VPPEASIATLNQLCATKFRVTQPNTFGLFLYKEQGYHRLPPGALAHRLPT TGYLVYRRAEWPETQGAVTEEEGSGQSEARSRGEEQGCQGDGDAGVKASP RDIREQSETT
    • Amino acids
      646 to 755
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160574 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ras and Rab interactor 1
    • ras inhibitor
    • ras inhibitor 1
    • Ras inhibitor JC99
    • ras inhibitor RIN1
    • Ras interaction/interference protein 1
    • RIN 1
    see all
  • Relevance
    RIN1 is a Ras effector protein which can affect Ras signaling in a variety of ways. It enhances signaling from ABL1 and ABL2 whcih are involved in regulation of cytoskeletal remodeling. It may function as a guanine nucleotide exchange factor in activation of Rab5a. Rin1 also competes with RAF1 for binding of the activated form of Ras. It may play a role inhibiting the modulation of neuronal plasticity in formation of aversive memory, and has been implicated as a tumor supressor gene in breast cancer.
  • Cellular localization
    Cytoplasmic and Plasma membrane

Images

  • ab160574 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160574 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160574.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up