Overview

  • Product name
    Recombinant Human RIN2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQICAEKFKVGDPEEYS LFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKRIKNDPYGIIF QNGEEDLTT
    • Amino acids
      786 to 894
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162740 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MACS
    • RAB5 interacting protein 2
    • Ras and Rab interactor 2
    • RAS association (RalGDS/AF-6) domain containing protein JC265
    • Ras association domain family 4
    • Ras inhibitor JC265
    • Ras interaction/interference protein 2
    • RASSF4
    • RIN 2
    • RIN2
    • RIN2_HUMAN
    see all
  • Function
    Ras effector protein. May function as an upstream activator and/or downstream effector for RAB5B in endocytic pathway. May function as a guanine nucleotide exchange (GEF) of RAB5B, required for activating the RAB5 proteins by exchanging bound GDP for free GTP.
  • Tissue specificity
    Widely expressed. Expressed in heart, kidney, lung placenta. Expressed at low level in skeletal muscle, spleen and peripheral blood.
  • Involvement in disease
    Defects in RIN2 are the cause of MACS syndrome (MACS) [MIM:613075]; also called macrocephaly alopecia cutis laxa and scoliosis syndrome. MACS is an autosomal-recessive inherited complex disorder of elastic tissue, characterized by sagging skin and occasionally by life-threatening visceral complications.
  • Sequence similarities
    Belongs to the RIN (Ras interaction/interference) family.
    Contains 1 Ras-associating domain.
    Contains 1 SH2 domain.
    Contains 1 VPS9 domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab162740 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162740 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162740.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up