Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ06587
    • SpeciesHuman
    • SequenceMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRS GNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLS RLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEG EGDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGS EDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYC QTRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGP DGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSL TLELVNEKFWKVSRPLELCYAPTKDPK
    • Molecular weight67 kDa including tags
    • Amino acids1 to 377
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112348 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesuseful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Ring1A
    • E3 ubiquitin-protein ligase RING1
    • Polycomb complex protein RING1
    • Really interesting new gene 1 protein
    • RING finger protein 1
    • Ring1
    • RING1_HUMAN
    • RING1A
    • Rnf1
    • Transcription repressor Ring1A
    see all
  • FunctionConstitutes one of the E3 ubiquitin-protein ligases that mediate monoubiquitination of 'Lys-119' of histone H2A, thereby playing a central role in histone code and gene regulation. H2A 'Lys-119' ubiquitination gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. Essential component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex act via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility. Compared to RNF2/RING2, it does not have the main E3 ubiquitin ligase activity on histone H2A, and it may rather act as a modulator of RNF2/RING2 activity.
  • PathwayProtein modification; protein ubiquitination.
  • Sequence similaritiesContains 1 RING-type zinc finger.
  • Cellular localizationNucleus speckle.
  • Information by UniProt

Recombinant Human RING1 protein images

  • 12.5% SDS-PAGE showing ab112348 at approximately 67.47kDa stained with Coomassie Blue.

References for Recombinant Human RING1 protein (ab112348)

ab112348 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112348.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"