Recombinant Human RING2 / RING1B / RNF2 protein (ab159360)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELM CPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSL RPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKI QAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTS DDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKT SGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASG QFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK
    • Amino acids
      1 to 336
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BAP 1
    • BAP1
    • DING
    • DinG protein
    • E3 ubiquitin protein ligase RING 2
    • E3 ubiquitin protein ligase RING2
    • E3 ubiquitin-protein ligase RING2
    • HIP2 interacting protein 3
    • HIP2-interacting protein 3
    • HIPI 3
    • HIPI3
    • Huntingtin interacting protein 2 interacting protein 3
    • Huntingtin-interacting protein 2-interacting protein 3
    • OTTHUMP00000060668
    • Polycomb M33 interacting protein Ring 1B
    • Polycomb M33 interacting protein Ring1B
    • Protein DinG
    • RING 1B
    • RING 2
    • RING finger protein 1B
    • RING finger protein 2
    • RING finger protein BAP 1
    • RING finger protein BAP-1
    • RING finger protein BAP1
    • RING1b
    • RING2_HUMAN
    • RNF 2
    • Rnf2
    see all
  • Function
    E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-119' of histone H2A, thereby playing a central role in histone code and gene regulation. H2A 'Lys-119' ubiquitination gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. May be involved in the initiation of both imprinted and random X inactivation. Essential component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex act via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility. E3 ubiquitin-protein ligase activity is enhanced by BMI1/PCGF4. Acts as the main E3 ubiquitin ligase on histone H2A of the PRC1 complex, while RING1 may rather act as a modulator of RNF2/RING2 activity.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications
    Polyubiquitinated in the presence of UBE2D3 (in vitro).
    Monoubiquitinated, by auto-ubiquitination.
  • Cellular localization
    Nucleus. Chromosome. Enriched on inactive X chromosome (Xi) in female trophoblast stem (TS) cells as well as differentiating embryonic stem (ES) cells. The enrichment on Xi is transient during TS and ES cell differentiation. The association with Xi is mitotically stable in non-differentiated TS cells.
  • Information by UniProt

Images

  • ab159360 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up