Recombinant Human RING6a protein (ab164499)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AVPQPVPSSKGRSKKVLESVFRIPPELDMSLLLEFIGANEGTGHFKPLEK KFVRVSGEATIGHVEKFLRRKMGLDPACQVDIICGDHLLEQYQTLREIRR
    • Amino acids
      225 to 324
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164499 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MBLR
    • Mel18 and Bmi1 like RING finger protein
    • Mel18 and Bmi1-like RING finger
    • Pcgf6
    • PCGF6_HUMAN
    • Polycomb group RING finger protein 6
    • RING finger protein 134
    • RNF134
    see all
  • Function
    Transcriptional repressor. May modulate the levels of histone H3K4Me3 by activating KDM5D histone demethylase.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications
    Phosphorylated during mitosis. Phosphorylated on Ser-30 by CDK7 in vitro.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab164499 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164499 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164499.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up