Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NMLWHAGKVWLIDVSQSVEPTHPHGLEFLFRDCRNVSQKGGVKEALSERE LFNAVSGLNITADNEADFLAEIEALEKMNEDHVQKNGRKAASFLKDDGDP PLLYDE
    • Amino acids
      411 to 516
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160183 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Homolog of the Aspergillus nidulans sudD gene product
    • RIO kinase 3
    • RIO kinase 3 (yeast)
    • RIOK3
    • RIOK3_HUMAN
    • Serine/threonine protein kinase RIO3
    • Serine/threonine-protein kinase RIO3
    • SUDD
    • SudD (suppressor of bimD6, Aspergillus nidulans) homolog
    • sudD homolog
    • SudD suppressor of Aspergillus nidulans bimD6 homolog
    • SudD suppressor of bimD6 homolog
    see all
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the protein kinase superfamily. RIO-type Ser/Thr kinase family.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab160183 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160183 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160183.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up