Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQ IDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDL LSSLIYVSQN
    • Amino acids
      562 to 671
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152911 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cell death protein RIP
    • FLJ39204
    • OTTHUMP00000039163
    • Receptor (TNFRSF) interacting serine threonine kinase 1
    • Receptor interacting protein
    • receptor interacting protein 1
    • Receptor interacting protein kinase 1
    • Receptor interacting serine threonine protein kinase 1
    • Receptor TNFRSF interacting serine threonine kinase 1
    • Receptor-interacting protein 1
    • Receptor-interacting serine/threonine-protein kinase 1
    • Rinp
    • RIP
    • RIP 1
    • Rip-1
    • RIP1
    • RIPK 1
    • Ripk1
    • RIPK1_HUMAN
    • Serine threonine protein kinase RIP
    • Serine/threonine-protein kinase RIP
    see all
  • Function
    Essential adapter molecule for the activation of NF-kappa-B. Following different upstream signals (binding of inflammatory cytokines, stimulation of pathogen recognition receptors, or DNA damage), particular RIPK1-containing complexes are formed, initiating a limited number of cellular responses. Upon TNFA stimulation RIPK1 is recruited to a TRADD-TRAF complex initiated by TNFR1 trimerization. There, it is ubiquitinated via 'Lys-63'-link chains, inducing its association with the IKK complex, and its activation through NEMO binding of polyubiquitin chains.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
    Contains 1 death domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Proteolytically cleaved by caspase-8 during TNF-induced apoptosis. Cleavage abolishes NF-kappa-B activation and enhances pro-apototic signaling through the TRADD-FADD interaction.
    Autophosphorylated on serine and threonine residues.
    Ubiquitinated by 'Lys-11'-, 'Lys-48'-, 'Lys-63'- and linear-linked type ubiquitin. Polyubiquitination with 'Lys-63'-linked chains by TRAF2 induces association with the IKK complex. Deubiquitination of 'Lys-63'-linked chains and polyubiquitination with 'Lys-48'-linked chains by TNFAIP3 leads to RIPK1 proteasomal degradation and consequently to the termination of the TNF- or Linear polyubiquitinated; the head-to-tail polyubiquitination is mediated by the LUBAC complex. LPS-mediated activation of NF-kappa-B. Also ubiquitinated with 'Lys-11'-linked chains.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab152911 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152911 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152911.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up