Recombinant Human RIP140 protein (ab152843)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KNEYEKDSPRLTKTNPILYYMLQKGGNSVTSRETQDKDIWREASSAESVS QVTAKEELLPTAETKASFFNLRSPYNSHMGNNASRPHSANGEVYGLLGSV LTIKKESE
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1051 to 1158

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152843 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • NRIP 1
    • NRIP1
    • NRIP1_HUMAN
    • Nuclear factor RIP 140
    • Nuclear factor RIP140
    • Nuclear receptor interacting protein 1
    • Nuclear receptor-interacting protein 1
    • Receptor interacting protein 140
    • Receptor-interacting protein 140
    • RIP 140
    • RIP140
    see all
  • Function
    Modulates transcriptional activation by steroid receptors such as NR3C1, NR3C2 and ESR1. Also modulates transcriptional repression by nuclear hormone receptors.
  • Domain
    Contains 9 Leu-Xaa-Xaa-Leu-Leu (LXXLL) motifs, which have different affinities for nuclear receptors. The C-terminal LTKTNPILYYMLQK motif is required for ligand-dependent interaction with RAAR and RXRB homodimers and heterodimers, for the corepressor activity, and for the formation of an HDAC3 complex with RARA/RXRB (By similarity). Contains at least four autonomous repression domains (RD1-4). RD1 functions via a histone deacetylase (HDAC)-independent mechanism, whereas RD2, RD3 and RD4 can function by HDAC-dependent or independent mechanisms, depending on cell type. RD2 is dependent on CTBP binding.
  • Post-translational
    modifications
    Acetylation regulates its nuclear translocation and corepressive activity (By similarity). Acetylation abolishes interaction with CTBP1. Phosphorylation enhances interaction with YWHAH.
  • Cellular localization
    Nucleus. Localized to discrete foci and redistributes to larger nuclear domains upon binding to ligand-bound NR3C1.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152843 stained with Coomassie Blue.

References

ab152843 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152843.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up