Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTK PTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSP SLNLLQNKSM
    • Amino acids
      431 to 540
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152912 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CARD 3
    • CARD carrying kinase
    • CARD containing ICE associated kinase
    • CARD containing IL 1 beta ICE kinase
    • CARD containing IL1 beta ICE kinase
    • CARD containing interleukin 1 beta converting enzyme (ICE) associated kinase
    • CARD containing interleukin 1 beta converting enzyme associated kinase
    • CARD-containing IL-1 beta ICE-kinase
    • CARD-containing interleukin-1 beta-converting enzyme-associated kinase
    • CARD3
    • CARDIAK
    • CCK
    • CLARP kinase
    • GIG 30
    • GIG30
    • Growth inhibiting gene 30
    • Receptor interacting protein (RIP) like interacting caspase like apoptosis regulatory protein (CLARP) kinase
    • Receptor interacting protein 2
    • Receptor interacting serine threonine kinase 2
    • Receptor interacting serine/threonine protein kinase 2
    • Receptor-interacting protein 2
    • Receptor-interacting serine/threonine-protein kinase 2
    • RICK
    • RIP 2
    • RIP like interacting CLARP kinase
    • RIP-2
    • RIP-like-interacting CLARP kinase
    • RIPK 2
    • Ripk2
    • RIPK2_HUMAN
    • TNFRSF
    • Tyrosine-protein kinase RIPK2
    • UNQ277/PRO314/PRO34092
    see all
  • Function
    Activates pro-caspase-1 and pro-caspase-8. Potentiates CASP8-mediated apoptosis. Activates NF-kappa-B.
  • Tissue specificity
    Detected in heart, brain, placenta, lung, peripheral blood leukocytes, spleen, kidney, testis, prostate, pancreas and lymph node.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
    Contains 1 CARD domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated. Phosphorylated upon DNA damage, probably by ATM or ATR.
    Ubiquitinated; undergoes 'Lys-63'-linked polyubiquitination catalyzed by ITCH.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab152912 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152912 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152912.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up