Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLT MQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSG K
    • Molecular weight
      37 kDa including tags
    • Amino acids
      418 to 518

Specifications

Our Abpromise guarantee covers the use of ab112398 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

    Other

  • Form
    Liquid
  • Additional notes
    Best to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • Receptor interacting protein 3
    • Receptor interacting serine threonine kinase 3
    • Receptor interacting serine/threonine protein kinase 3
    • Receptor-interacting protein 3
    • Receptor-interacting serine/threonine-protein kinase 3
    • RIP 3
    • RIP like protein kinase 3
    • RIP-3
    • RIP-like protein kinase 3
    • RIPK 3
    • RIPK3
    • RIPK3_HUMAN
    see all
  • Function
    Promotes apoptosis.
  • Tissue specificity
    Detected at lower levels in heart, placenta, lung and kidney. Isoform 3 is significantly increased in colon and lung cancers.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human RIP3 protein images

  • 12.5% SDS-PAGE analysis of ab112398. Stained with Coomassie Blue

References for Recombinant Human RIP3 protein (ab112398)

ab112398 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112398.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up