Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVS ADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGP AATLLRRSKT
    • Amino acids
      675 to 784
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ANKK 2
    • ANKK2
    • ANKRD 3
    • ANKRD3
    • Ankyrin repeat domain 3
    • ankyrin repeat domain containing protein 3
    • Ankyrin repeat domain protein 3
    • DIK
    • MGC129992
    • MGC129993
    • PKC delta interacting protein kinase
    • PKK
    • protein kinase C-associated kinase
    • Receptor interacting serine threonine kinase 4
    • Receptor interacting serine/threonine protein kinase 4
    • RIP 4
    • RIP4
    • RIPK 4
    • Serine/threonine protein kinase ANKRD3
    see all
  • Relevance
    RIPK4 (receptor-interacting serine-threonine kinase 4) is a serine/threonine protein kinase which undergoes autophosphorylation. It can activate NFkappaB and is required for keratinocyte differentiation. It interacts with protein kinase C-delta (PRKCD).
  • Cellular localization
    Cytoplasm. Membrane; Peripheral membrane protein.

Images

  • ab162717 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162717 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162717.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up