Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPSSLFADLERNGSGGGGGGSSGGGETLDDQRALQLALDQLSLLGLDSDE GASLYDSEPRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYI KTPVRGEEPVFVVTGRKEDVAMARREIISAAEHFSMIRASRNKNTALNGA VPGPPNLPGQTTIQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRD KEPVFEVTGMPENVDRAREEIEAHIALRTGGIIELTDENDFHANGTDVGF DLHHGSGGSGPGSLWSKPTPSITPTPGRKPFSSYRNDSSSSLGSASTDSY FGGGTSSSAAATQRLADYSPPSPALSFAHNGNNNNNGNGYTYTAGGEASV PSPDGCPELQPTFDPAPAPPPGAPLIWAQFERSPGGGPAAPVSSSCSSSA SSSASSSSVVFPGSGASAPSNANLGLLVHRRLHPGTSCPRLSPPLHMAPG AGEHHLARRVRSDPGGGGLAYAAYANGLGAQLPGLQPSDTSGSSSSSSSS SSSSSSSSGLRRKGSRDCSVCFESEVIAALVPCGHSLFCMECANRICEKS EPECPVCHTAVTQAIRIFS
    • Amino acids
      1 to 569
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164522 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA2009
    • mex3b
    • MEX3B_HUMAN
    • RING finger and KH domain-containing protein 3
    • RING finger protein 195
    • RNA binding protein MEX3B
    • RNA-binding protein MEX3B
    • RNF195
    see all
  • Function
    RNA-binding protein. May be involved in post-transcriptional regulatory mechanisms.
  • Tissue specificity
    Highest levels found in fetal brain and testis. Detected in the adult intestinal epithelium, specifically in goblet cell at protein level.
  • Sequence similarities
    Contains 2 KH domains.
    Contains 1 RING-type zinc finger.
  • Domain
    Binds RNA through its KH domains.
  • Post-translational
    modifications
    Phosphorylated.
  • Cellular localization
    Nucleus. Cytoplasm. Cytoplasm > P-body. Predominantly expressed in the cytoplasm and shuttles between the cytoplasm and the nucleus through the CRM1 export pathway.
  • Information by UniProt

Images

  • ab164522 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164522 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164522.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up