Recombinant Human RLBP1L1 protein (ab165692)

Overview

  • Product name
    Recombinant Human RLBP1L1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGPVSLLPKYQKLNTWNGDLAKMTHLQAGLSPETIEKARLELNENPDVLH QDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQY RQLNLDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQ SRNSFTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLTPS ILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFL HGNNLNSLHQLIHPEFLPSEFGGTLPPYDMGTWARTLLGPDYSDENDYTH TSYNAMHVKHTSSNLERECSPKLMKRSQSVVEAGTLKHEEKGENENTQPL LALD
    • Amino acids
      1 to 354
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cellular retinaldehyde binding protein like
    • CRALBPL
    • FLJ37248
    • Retinaldehyde binding protein 1 like 1
    • RLBP1L1
    see all
  • Relevance
    RLBP1L1 is a protein of unknown function. It has 45% identity with human CRALBP (Cellular retinaldehyde-binding protein) which carries 11-cis-retinol or 11-cis-retinaldehyde as endogenous ligands and may function as a substrate carrier protein that modulates interaction of these retinoids with visual cycle enzymes. RLBP1L1 is expressed in brain, and several human carcinoma cell lines.
  • Cellular localization
    Cytoplasmic

Images

  • ab165692 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165692 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165692.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up