Overview

  • Product name
    Recombinant Human RMI2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGR GPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGK YVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
    • Amino acids
      1 to 147
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165089 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BLAP18
    • BLM-associated protein of 18 kDa
    • C16orf75
    • hRMI2
    • MGC24665
    • RecQ-mediated genome instability protein 2
    • RMI2
    • RMI2_HUMAN
    see all
  • Function
    Essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates to limit DNA crossover formation in cells. The complex is therefore essential for the stability, localization, and function of complexes containing BLM. In the RMI complex, it is required to target BLM to chromatin and stress-induced nuclear foci and mitotic phosphorylation of BLM.
  • Sequence similarities
    Belongs to the RMI2 family.
    Contains 1 OB DNA-binding domain.
  • Post-translational
    modifications
    Phosphorylated during mitosis.
  • Cellular localization
    Nucleus. Colocalizes with BLM at nuclear DNA repair foci.
  • Information by UniProt

Images

  • ab165089 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165089 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165089.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up