Recombinant Human RNA Helicase A protein (ab114300)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ08211
    • SpeciesHuman
    • SequenceMGDVKNFLYAWCGKRKMTPTYEIRAVGNKNRQKFMCEVQVEGYNYTGMGN STNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
    • Molecular weight36 kDa including tags
    • Amino acids1 to 90

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114300 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP dependent RNA helicase A
    • ATP-dependent RNA helicase A
    • DDX 9
    • DDX9
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide 9
    • DEAD/H box 9
    • DEAD/H box polypeptide 9
    • DEAH (Asp Glu Ala His) box polypeptide 9
    • DEAH box polypeptide 9
    • DEAH box protein 9
    • DHX 9
    • dhx9
    • DHX9_HUMAN
    • Leukophysin
    • LKP
    • NDH 2
    • NDH II
    • NDH2
    • NDHII
    • Nuclear DNA helicase II
    • RHA
    see all
  • FunctionUnwinds double-stranded DNA and RNA in a 3' to 5' direction. Alteration of secondary structure may subsequently influence interactions with proteins or other nucleic acids. Functions as a transcriptional activator. Component of the CRD-mediated complex that promotes MYC mRNA stability.
  • Sequence similaritiesBelongs to the DEAD box helicase family. DEAH subfamily.
    Contains 2 DRBM (double-stranded RNA-binding) domains.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • DomainThe MTAD domain mediates interaction with the RNA polymerase II holoenzyme. The NTD domain is necessary and sufficient for nucleo-cytoplasmic shuttling and interaction with HRMT1L2 and SMN1.
  • Post-translational
    modifications
    Methylated. HRMT1L2 mediated methylation of undefined Arg residues in the NTD is required for nuclear localization.
    May be phosphorylated by PRKDC/XRCC7. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus > nucleolus. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Can shuttle between nucleus and cytoplasm.
  • Information by UniProt

Recombinant Human RNA Helicase A protein images

  • 12.5% SDS-PAGE image showing ab114300 Stained with Coomassie Blue.

References for Recombinant Human RNA Helicase A protein (ab114300)

ab114300 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114300.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"