Recombinant Human RNA Helicase A protein (ab114300)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGDVKNFLYAWCGKRKMTPTYEIRAVGNKNRQKFMCEVQVEGYNYTGMGN STNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 90

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114300 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP dependent RNA helicase A
    • ATP-dependent RNA helicase A
    • DDX 9
    • DDX9
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide 9
    • DEAD/H box 9
    • DEAD/H box polypeptide 9
    • DEAH (Asp Glu Ala His) box polypeptide 9
    • DEAH box polypeptide 9
    • DEAH box protein 9
    • DHX 9
    • dhx9
    • DHX9_HUMAN
    • Leukophysin
    • LKP
    • NDH 2
    • NDH II
    • NDH2
    • NDHII
    • Nuclear DNA helicase II
    • RHA
    see all
  • Function
    Unwinds double-stranded DNA and RNA in a 3' to 5' direction. Alteration of secondary structure may subsequently influence interactions with proteins or other nucleic acids. Functions as a transcriptional activator. Component of the CRD-mediated complex that promotes MYC mRNA stability.
  • Sequence similarities
    Belongs to the DEAD box helicase family. DEAH subfamily.
    Contains 2 DRBM (double-stranded RNA-binding) domains.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Domain
    The MTAD domain mediates interaction with the RNA polymerase II holoenzyme. The NTD domain is necessary and sufficient for nucleo-cytoplasmic shuttling and interaction with HRMT1L2 and SMN1.
  • Post-translational
    modifications
    Methylated. HRMT1L2 mediated methylation of undefined Arg residues in the NTD is required for nuclear localization.
    May be phosphorylated by PRKDC/XRCC7. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus > nucleolus. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Can shuttle between nucleus and cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE image showing ab114300 Stained with Coomassie Blue.

References

ab114300 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114300.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up