Recombinant Human RNA polymerase II RPB4 protein (ab159154)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAGGSDPRAGDVEEDASQLIFPKGFETAETLLNSEVHMLLEHRKQQNES AEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACL ANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
    • Amino acids
      1 to 142
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159154 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DNA directed RNA polymerase II 16 kDa polypeptide
    • DNA directed RNA polymerase II subunit D
    • DNA directed RNA polymerase II subunit RPB4
    • DNA-directed RNA polymerase II 16 kDa polypeptide
    • DNA-directed RNA polymerase II subunit D
    • DNA-directed RNA polymerase II subunit rpb4
    • HSRBP4
    • HSRPB4
    • polr2d
    • polymerase RNA II DNA directed polypeptide D
    • RBP4
    • RNA polymerase II 16 kDa subunit
    • RNA polymerase II subunit B4
    • RNA polymerase II subunit D
    • RNA polymerase II subunit hsRBP4
    • RPB16
    • RPB4_HUMAN
    see all
  • Function
    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB4 is part of a subcomplex with RPB7 that binds to a pocket formed by RPB1, RPB2 and RPB6 at the base of the clamp element. The RBP4-RPB7 subcomplex seems to lock the clamp via RPB7 in the closed conformation thus preventing double stranded DNA to enter the active site cleft. The RPB4-RPB7 subcomplex binds single-stranded DNA and RNA.
  • Sequence similarities
    Belongs to the eukaryotic RPB4 RNA polymerase subunit family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159154 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159154 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159154.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up