Overview

  • Product name
    Recombinant Human RND3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMKERRASQKLSSKSIMDPNQNVKCKIVVVG DSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSLWDTSG SPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKM LLVGCKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSAL QSENSVRDIFHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVA TDLRKDKAKSC
    • Molecular weight
      29 kDa including tags
    • Amino acids
      1 to 241
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab97952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab97952 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • ARHE
    • memB
    • Protein MemB
    • Ras homolog gene family member E
    • Rho family GTPase 3
    • Rho-related GTP-binding protein Rho8
    • Rho-related GTP-binding protein RhoE
    • Rho8
    • RhoE
    • Rnd3
    • RND3_HUMAN
    • Small GTP binding protein Rho8
    see all
  • Function
    Binds GTP but lacks intrinsic GTPase activity and is resistant to Rho-specific GTPase-activating proteins.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rho family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab97952 at approximately 29.2kDa (3µg).

References

ab97952 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab97952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up