Overview

  • Product name
    Recombinant Human RND3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMKERRASQKLSSKSIMDPNQNVKCKIVVVG DSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSLWDTSG SPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKM LLVGCKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSAL QSENSVRDIFHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVA TDLRKDKAKSC
    • Molecular weight
      29 kDa including tags
    • Amino acids
      1 to 241
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab97952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab97952 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • ARHE
    • memB
    • Protein MemB
    • Ras homolog gene family member E
    • Rho family GTPase 3
    • Rho-related GTP-binding protein Rho8
    • Rho-related GTP-binding protein RhoE
    • Rho8
    • RhoE
    • Rnd3
    • RND3_HUMAN
    • Small GTP binding protein Rho8
    see all
  • Function
    Binds GTP but lacks intrinsic GTPase activity and is resistant to Rho-specific GTPase-activating proteins.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rho family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Recombinant Human RND3 protein images

  • 15% SDS-PAGE showing ab97952 at approximately 29.2kDa (3µg).

References for Recombinant Human RND3 protein (ab97952)

ab97952 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab97952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up