Recombinant Human RNF128 protein (ab164041)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VDVEDGSVSLQVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLE EHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQETAVREIKS
    • Amino acids
      329 to 428
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164041 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin protein ligase RNF128
    • E3 ubiquitin-protein ligase RNF128
    • FLJ23516
    • Gene related to anergy in lymphocytes protein
    • GRAIL
    • RING finger protein 128
    • RN128_HUMAN
    • RNF128
    see all
  • Function
    E3 ubiquitin-protein ligase that catalyzes polyubiquitin chains. Functions as an inhibitor of cytokine gene transcription. Inhibits IL2 and IL4 transcription and this activity is likely to be mediated by E3 ligase activity. Plays an important role in the induction of the anergic phenotype. Functions in the patterning of the dorsal ectoderm; sensitizes ectoderm to respond to neural-inducing signals.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 PA (protease associated) domain.
    Contains 1 RING-type zinc finger.
  • Domain
    Binding to E2 ubiquitin-conjugating enzyme requires an intact RING finger domain.
  • Post-translational
    modifications
    Auto-ubiquitinated. Controls the development of T cell clonal anergy by ubiquitination.
  • Cellular localization
    Endomembrane system. Cytoplasm > perinuclear region. Localized in an asymmetric perinuclear punctate manner. Localizes to the internal pool of the transferrin recycling endosomal pathway. Partially colocalized with the endoplasmic reticulum resident HSPA5, with Golgi resident STX5, and with the late endosomal GTPase RAB7.
  • Information by UniProt

Images

  • ab164041 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164041 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164041.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up