Recombinant Human RNF139 protein (ab161366)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETP EEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD
    • Amino acids
      565 to 664
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161366 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin-protein ligase RNF139
    • HRCA1
    • RCA1
    • Ring finger protein 139
    • Translocation in renal carcinoma on chromosome 8 protein
    • TRC8
    see all
  • Relevance
    RNF139 is a multi-membrane spanning protein E3 ubiquitin ligase which is mutated in clear-cell renal carcinomas. It contains a sterol-sensing domain and a RING-H2 motif essential for ubiquitin ligase activity. It is a potential tumor suppressor for renal cell carcinoma. Human kidney cells are growth inhibited by RNF139. Inhibition is manifested by G2/M arrest and is dependent upon the ubiquitin ligase activity of the RING domain. Expression of RNF139 represses genes involved in cholesterol and fatty acid biosynthesis that are transcriptionally regulated by the sterol response element binding proteins (SREBPs). RNF139 modulation of SREBP activity comprises a novel regulatory link between growth control and the cholesterol/lipid homeostasis pathway.
  • Cellular localization
    Endoplasmic reticulum membrane; Multi-pass membrane protein.

Images

  • ab161366 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161366 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161366.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up