Recombinant Human RNF166 protein (ab165088)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GPAGGDSGLEAQYTCPICLEVYHRPVAIGSCGHTFCGECLQPCLQVPSPL CPLCRLPFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRVHISSCL KVQEQMAN
    • Amino acids
      19 to 126
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165088 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1110031E24Rik
    • AW555115
    • MGC14381
    • MGC2647
    • RING finger protein 166
    • RN166_HUMAN
    • RNF 166
    • RNF166
    • Zfp313l
    • Zinc finger protein 228
    • Zinc finger protein 313
    see all
  • Sequence similarities
    Contains 1 RING-type zinc finger.
    Contains 1 UIM (ubiquitin-interacting motif) repeat.
  • Information by UniProt

Images

  • ab165088 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165088 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165088.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up