Recombinant Human RNF168 protein (ab153613)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALPKDAIPSLSECQCGICMEILVEPVTLPCNHTLCKPCFQSTVEKASLC CPFCRRRVSSWTRYHTRRNSLVNVELWTIIQKHYPRECKLRASGQESEEV ADDYQPVRLLSKPGELRREYEEEISKVAAERRASEEEENKASEEYIQRLL AEEEEEEKRQAEKRRRAMEEQLKSDEELARKLSIDINNFCEGSISASPLN SRKSDPVTPKSEKKSKNKQRNTGDIQKYLTPKSQFGSASHSEAVQEVRKD SVSKDIDSSDRKSPTGQDTEIEDMPTLSPQISLGVGEQGADSSIESPMPW LCACGAEWYHEGNVKTRPSNHGKELCVLSHERPKTRVPYSKETAVMPCGR TESGCAPTSGVTQTNGNNTGETENEESCLLISKEISKRKNQESSFEAVKD PCFSAKRRKVSPESSPDQEETEINFTQKLIDLEHLLFERHKQEEQDRLLA LQLQKEVDKEQMVPNRQKGSPDEYHLRATSSPPDKVLNGQRKNPKDGNFK RQTHTKHPTPERGSRDKNRQVSLKMQLKQSVNRRKMPNSTRDHCKVSKSA HSLQPSISQKSVFQMFQRCTK
    • Amino acids
      1 to 571
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153613 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin protein ligase RNF168
    • E3 ubiquitin-protein ligase RNF168
    • FLJ35794
    • FLJ39749
    • hRNF168
    • RING finger protein 168
    • RN168_HUMAN
    • RNF 168
    • Rnf168
    see all
  • Function
    E3 ubiquitin-protein ligase required for accumulation of repair proteins to sites of DNA damage. Acts with UBE2N/UBC13 to amplify the RNF8-dependent histone ubiquitination. Recruited to sites of DNA damage at double-strand breaks (DSBs) by binding to ubiquitinated histone H2A and ubiquitinates histone H2A and H2AX, leading to amplify the RNF8-dependent H2A ubiquitination and promoting the formation of 'Lys-63'-linked ubiquitin conjugates. This leads to concentrate ubiquitinated histones H2A and H2AX at DNA lesions to the threshold required for recruitment of TP53BP1 and BRCA1.
  • Pathway
    Protein modification; protein ubiquitination.
  • Involvement in disease
    Defects in RNF168 are the cause of Riddle syndrome (RIDDLES) [MIM:611943]. Riddle syndrome is characterized by increased radiosensitivity, immunodeficiency, mild motor control and learning difficulties, facial dysmorphism, and short stature. Defects are probably due to impaired localization of TP53BP1 and BRCA1 at DNA lesions.
  • Sequence similarities
    Belongs to the RNF168 family.
    Contains 1 RING-type zinc finger.
  • Domain
    The MIU motifs (motif interacting with ubiquitin) mediate the interaction with ubiquitin and the localization at sites of DNA damage.
  • Cellular localization
    Nucleus. Localizes to sites of DNA damage.
  • Information by UniProt

Images

  • ab153613 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153613 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153613.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up