Overview

  • Product name
    Recombinant Human RNF17 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IQCTRCGRRVSRSSGHHCELQCGHAFCELCLLMTEECTTIICPDCEVATA VNTRQRYYPMAGYIKEDSIMEKLQPKTIKNCSQDFKKTADQLTTGLERSA STDKTLLNSS
    • Amino acids
      30 to 139
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163354 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ11045
    • Mmip 2
    • Mmip2
    • OTTHUMP00000018139
    • OTTHUMP00000042342
    • Ring finger protein 17
    • RNF 17
    • SPATA 23
    • SPATA23
    • Spermatogenesis associated 23
    • TDRD 4
    • TDRD4
    • Tudor domain containing 4
    see all
  • Relevance
    RNF17 (Ring finger protein 17) is required for differentiation of male germ cells.

Images

  • ab163354 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163354 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163354.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up