Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RVESSRRAVSQIVTVYDKLQEKVELLSRKLNSGDNLIVEEAVQELNSFLA QENMRLQELTDLLQEKHRTMSQEFSKLQSKVETAESRVSVLESMIDDLQW
    • Amino acids
      177 to 276
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163369 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BRE1
    • BRE1 A
    • BRE1 E3 ubiquitin ligase homolog
    • BRE1-A
    • BRE1A
    • BRE1A_HUMAN
    • E3 ubiquitin-protein ligase BRE1A
    • hBRE1
    • Homolog of S. cerevisiae BRE1
    • RING finger protein 20
    • Ring finger protein 20 E3 ubiquitin protein ligase
    • Rnf20
    see all
  • Function
    Component of the RNF20/40 E3 ubiquitin-protein ligase complex that mediates monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1). H2BK120ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation (H3K4me and H3K79me, respectively). It thereby plays a central role inb histone code and gene regulation. The RNF20/40 complex forms a H2B ubiquitin ligase complex in cooperation with the E2 enzyme UBE2A or UBE2B; reports about the cooperation with UBE2E1/UBCH are contradictory. Required for transcriptional activation of Hox genes. Recruited to the MDM2 promoter, probably by being recruited by p53/TP53, and thereby acts as a transcriptional coactivator. Mediates the polyubiquitination of isoform 2 of PA2G4 in cancer cells leading to its proteasome-mediated degradation.
  • Tissue specificity
    Expressed in the normal brain and also in malignant gliomas (at protein level).
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the BRE1 family.
    Contains 1 RING-type zinc finger.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab163369 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163369 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163369.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up