Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAASASAAAGEEDWVLPSEVEVLESIYLDELQVIKGNGRTSPWEIYITLH PATAEDQDSQYVCFTLVLQVPAEYPHEVPQISIRNPRGLSDEQIHTILQV LGHVAKAGLGTAMLYELIEKGKEILTDNNIPHGQCVICLYGFQEKEAFTK TPCYHYFHCHCLARYIQHMEQELKAQGQEQEQERQHATTKQKAVGVQCPV CREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGG IIDLEAERNRYFISLQQPPAPAEPESAVDVSKGSQPPSTLAAELSTSPAV QSTLPPPLPVATQHICEKIPGTRSNQQRLGETQKAMLDPPKPSRGPWRQP ERRHPKGGECHAPKGTRDTQELPPPEGPLKEPMDLKPEPHSQGVEGPPQE KGPGSWQGPPPRRTRDCVRWERSKGRTPGSSYPRLPRGQGAYRPGTRRES LGLESKDGS
    • Amino acids
      1 to 459
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AO7
    • E3 ubiquitin protein ligase RNF25
    • E3 ubiquitin-protein ligase RNF25
    • EC 6.3.2.-
    • FLJ13906
    • RING finger protein 25
    • RING finger protein AO7
    • RNF 25
    • RNF25
    • RNF25_HUMAN
    see all
  • Function
    E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of NKD2 (By similarity). Stimulates transcription mediated by NF-kappa-B.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 RING-type zinc finger.
    Contains 1 RWD domain.
  • Domain
    The RING-type zinc finger domain interacts with an ubiquitin-conjugating enzyme (E2) and facilitates ubiquitination.
  • Post-translational
    modifications
    Ubiquitinated.
  • Information by UniProt

Images

  • ab163815 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163815 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up