Overview

  • Product name
    Recombinant Human RNF5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPC LHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQG QRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGV DLGQGHPASSWQDSLFLFLAIFFFFWLLSI
    • Amino acids
      1 to 180
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159362 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin protein ligase RNF5
    • E3 ubiquitin-protein ligase RNF5
    • G16
    • HsRma1
    • NG2
    • OTTHUMP00000029107
    • Protein G16
    • Ram1 homolog
    • RING finger protein 5
    • RING5
    • RMA1
    • RNF 5
    • RNF5
    • RNF5_HUMAN
    see all
  • Function
    Has E2-dependent E3 ubiquitin-protein ligase activity. May function together with E2 ubiquitin-conjugating enzymes UBE2D1/UBCH5A and UBE2D2/UBC4. Mediates ubiquitination of PXN/paxillin and Salmonella type III secreted protein sopA. May be involved in regulation of cell motility and localization of PXN/paxillin. Mediates the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD; the ubiquitination appears to involve E2 ubiquitin-conjugating enzyme UBE2N. Mediates the 'Lys-48'-linked polyubiquitination of TMEM173 at 'Lys-150' leading to its proteasomal degradation; the ubiquitination occurrs in mitochondria after viral transfection and regulates antiviral responses.
  • Tissue specificity
    Widely expressed.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 RING-type zinc finger.
  • Cellular localization
    Membrane. Mitochondrion membrane. Endoplasmic reticulum membrane. Predominantly located in the plasma membrane, with some localization occurring within cytoplasmic organelles.
  • Information by UniProt

Images

  • ab159362 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159362 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159362.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up