Recombinant Human RNMTL1 protein (ab163001)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAALVRPARFVVRPLLQVVQAWDLDARRWVRALRRSPVKVVFPSGEVVEQ KRAPGKQPRKAPSEASAQEQREKQPLEESASRAPSTWEESGLRYDKAYPG DRRLSSVMTIVKSRPFREKQGKILLEGRRLISDALKAGAVPKMFFFSRLE YLKELPVDKLKGVSLIKVKFEDIKDWSDLVTPQGIMGIFAKPDHVKMTYP KTQLQHSLPLLLICDNLRDPGNLGTILRSAAGAGCSKVLLTKGCVDAWEP KVLRAGMGAHFRMPIINNLEWETVPNYLPPDTRVYVADNCGLYAQAEMSN KASDHGWVCDQRVMKFHKYEEEEDVETGASQDWLPHVEVQSYDSDWTEAP AAVVIGGETYGVSLESLQLAESTGGKRLLIPVVPGVDSLNSAMAASILLF EGKRQLRGRAEDLSRDRSYH
    • Amino acids
      1 to 420
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163001 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 16S rRNA (guanosine(1370)-2'-O)-methyltransferase
    • 16S rRNA [Gm1370] 2'-O-methyltransferase
    • 4833420N02Rik
    • AI255153
    • FLJ10581
    • HC90
    • MRM3
    • MRM3_HUMAN
    • Putative RNA methyltransferase
    • RMTL1
    • RNA methyltransferase like 1
    • RNA methyltransferase like protein 1
    • RNA methyltransferase-like protein 1
    • RP23-147P4.7
    • rRNA methyltransferase 3, mitochondrial
    see all
  • Function
    S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of 2'-O-methylguanosine at position 1370 (Gm1370) in the 16S mitochondrial large subunit ribosomal RNA (mtLSU rRNA), a conserved modification in the peptidyl transferase domain of the mtLSU rRNA.
  • Tissue specificity
    Expressed at same level in normal liver and hepatocarcinoma.
  • Sequence similarities
    Belongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase TrmH family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab163001 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163001 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163001.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up